PDB entry 1w9q

View 1w9q on RCSB PDB site
Description: crystal structure of the pdz tandem of human syntenin in complex with tnefaf peptide
Class: adhesion/complex
Keywords: adhesion/complex, pdz domain, scaffolding protein
Deposited on 2004-10-15, released 2006-03-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17594
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: HOMO SAPIENS
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9Q
    • Uniprot O00560 (5-165)
    Domains in SCOP 1.73: d1w9qa1, d1w9qa2
  • Chain 'B':
    Compound: Syntenin 1
    Species: HOMO SAPIENS
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9Q
    • Uniprot O00560 (5-165)
    Domains in SCOP 1.73: d1w9qb1, d1w9qb2
  • Chain 'S':
    Compound: tnefaf peptide
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9qA (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9qA (A:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9qB (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9qB (B:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'S':
    No sequence available.