PDB entry 1w9q

View 1w9q on RCSB PDB site
Description: Crystal structure of the PDZ tandem of human syntenin in complex with TNEFAF peptide
Class: cell adhesion
Keywords: cell adhesion, adhesion-complex, pdz domain, scaffolding protein
Deposited on 2004-10-15, released 2006-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9Q (Start-4)
    • Uniprot O00560 (5-165)
    Domains in SCOPe 2.07: d1w9qa1, d1w9qa2, d1w9qa3
  • Chain 'B':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9Q (Start-4)
    • Uniprot O00560 (5-165)
    Domains in SCOPe 2.07: d1w9qb1, d1w9qb2, d1w9qb3
  • Chain 'S':
    Compound: tnefaf peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9Q (Start-5)
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9qA (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9qA (A:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9qB (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9qB (B:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'S':
    No sequence available.