PDB entry 1w9m

View 1w9m on RCSB PDB site
Description: as-isolated hybrid cluster protein from desulfovibrio vulgaris x-ray structure at 1.35a resolution using iron anomalous signal
Class: oxidoreductase
Keywords: hybrid cluster protein, anaerobic, oxidised, as-isolated, desulfovibrio vulgaris, oxidoreductase
Deposited on 2004-10-14, released 2005-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.125
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxylamine reductase
    Species: DESULFOVIBRIO VULGARIS [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9ma_
  • Heterogens: SF4, FS2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w9mA (A:)
    mfcfqcqetakntgctvkgmcgkpeetanlqdllifvlrgiaiygeklkelgqpdrsndd
    fvlqglfatitnanwddarfeamiseglarrdklrnaflavykakngkdfseplpeaatw
    tgdstafaekaksvgilatenedvrslrelliiglkgvaayaehaavlgfrkteidefml
    ealasttkdlsvdemvalvmkaggmavttmalldeantttygnpeitqvnigvgknpgil
    isghdlkdmaellkqtegtgvdvythgemlpanyypafkkyphfvgnyggswwqqnpefe
    sfngpillttnclvplkkentyldrlyttgvvgyegakhiadrpaggakdfsaliaqakk
    cpppveietgsivggfahhqvlaladkvveavksgaikrfvvmagcdgrqksrsyyteva
    enlpkdtviltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgldd
    indlpvsydiawyeqkavavllallflgvkgirlgptlpaflspnvakvlvenfnikpig
    tvqddiaammagk