PDB entry 1w9l

View 1w9l on RCSB PDB site
Description: myosin ii dictyostelium discoideum motor domain s456e bound with mgadp-alf4
Deposited on 2004-10-13, released 2006-03-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (0-End)
      • conflict (248)
      • conflict (311)
      • engineered mutation (455)
    • PDB 1W9L
  • Heterogens: MG, ADP, ALF, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w9lA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldiegfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearelrgdykddddk
    

    Sequence, based on observed residues (ATOM records):
    >1w9lA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrvleqqilqanpileafgnakttrnnnssrfgkfieiqf
    nsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnyl
    nqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagega
    vlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalyg
    rlflwlvkkinnvlcqerkayfigvldiegfeifkvnsfeqlcinytneklqqffnhhmf
    kleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitkl
    hshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnv
    vtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakl
    edkvvldqlrcngvlegiritrkgfpnriiyadfvkrydaedsqkatdavldpeqyrfgi
    tkiffr