PDB entry 1w9k

View 1w9k on RCSB PDB site
Description: dictyostelium discoideum myosin ii motor domain s456e with bound mgadp-befx
Deposited on 2004-10-13, released 2006-03-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • conflict (442)
      • engineered mutation (455)
      • conflict (736)
    • PDB 1W9K
  • Heterogens: MG, ADP, BEF, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w9kA (A:)
    mdpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlceerkayfigvldiegfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqfrfgitkiffragqlarieearelrgdykddddk
    

    Sequence, based on observed residues (ATOM records):
    >1w9kA (A:)
    dpihdrtsdyhkylkvkqgddkryiwynpdpkerdsyecgeivsetsdsftfktvdgqdr
    qvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvavnpfk
    ripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagktentk
    kviqylasvagrgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnsagfisga
    siqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgcvdik
    gvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdktaln
    aastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflwlvkk
    innvlceerkayfigvldiegfeifkvnsfeqlcinytneklqqffnhhmfkleqeeylk
    ekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskkna
    kyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndpn
    iasrakfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcng
    vlegiritrkgfpnriiyadfvkedsqkatdavlkhldpeqfrfgitkiffragqlari