PDB entry 1w9h

View 1w9h on RCSB PDB site
Description: The Structure of a Piwi protein from Archaeoglobus fulgidus.
Class: nuclear protein
Keywords: argonaute, piwi domain, rnai, risc, nuclear protein
Deposited on 2004-10-13, released 2005-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein af1318
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w9ha2, d1w9ha3
  • Heterogens: CD, NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9hA (A:)
    mmeykivengltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfssl
    inqlksqisskidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeynt
    plyyklksylinsipsqfmrydilsnrnltfyvdnllvqfvsklggkpwilnvdpekgsd
    iiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylkstikkvvygfkks
    npdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyailhlnethpfwv
    mgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsveivsdnwtseey
    yhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrsl
    qtnpwfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9hA (A:)
    ltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfsslinqlksqiss
    kidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntplyyklksyl
    insipsqfmrydiltfyvdnllvqfvsklggkpwilnvdpekgsdiiigtgatridnvnl
    fcfamvfkkdgtmlwneispivtsseyltylkstikkvvygfkksnpdwdvekltlhvsg
    krpkmkdgetkilketveelkkqemvsrdvkyailhlnethpfwvmhpyegtkvklsskr
    ylltllqpylvtpikplsveivsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpv
    tvnypklvagiianvnryggypinpegnrslqtnpwfl