PDB entry 1w9g

View 1w9g on RCSB PDB site
Description: structure of erh (enhencer of rudimentary gene)
Class: erh(enhancer of rudimentary homolog)
Keywords: erh(enhancer of rudimentary homolog), dcoh(dimerization cofactor of hnf1)
Deposited on 2004-10-13, released 2005-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancer of rudimentary homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9ga_
  • Chain 'B':
    Compound: Enhancer of rudimentary homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9gA (A:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
    iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9gA (A:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
    iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9gB (B:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
    iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9gB (B:)
    mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnstydisqlfdfidd
    ladlsclvyradtqtyqpynkdwikekiyvllrrqaqqag