PDB entry 1w9f

View 1w9f on RCSB PDB site
Description: cbm29-2 mutant r112a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Class: carbohydrate binding domain
Keywords: carbohydrate binding domain, glucomannan, cellohexaose, mannohexaose, cellulosome
Deposited on 2004-10-12, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171 (Start-144)
      • engineered mutation (111)
    • PDB 1W9F (145-End)
    Domains in SCOPe 2.07: d1w9fa_
  • Chain 'B':
    Compound: non catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171
      • engineered mutation (111)
    • PDB 1W9F
    Domains in SCOPe 2.07: d1w9fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9fA (A:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdaidfqdapg
    ngdriwiknlvhstgsaddfvdpinlhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9fA (A:)
    vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
    lrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdaidfqdapgng
    driwiknlvhstgsaddfvdpinl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9fB (B:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdaidfqdapg
    ngdriwiknlvhstgsaddfvdpinlhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9fB (B:)
    atytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggslr
    fdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdaidfqdapgngdr
    iwiknlvhstgsaddfvdpi