PDB entry 1w9c

View 1w9c on RCSB PDB site
Description: Proteolytic fragment of CRM1 spanning six C-terminal HEAT repeats
Class: nuclear protein
Keywords: nuclear protein, exportin 1, nuclear export complex
Deposited on 2004-10-08, released 2004-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crm1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9ca_
  • Chain 'B':
    Compound: crm1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w9cA (A:)
    viqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrs
    ndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdav
    fectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtm
    rnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasil
    aymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnq
    dipafkehlrdflvqikefag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w9cB (B:)
    viqlgriyldmlnvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrs
    ndpqmvaenfvpplldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdav
    fectlnminkdfeeypehrtnfflllqavnshcfpaflaipptqfklvldsiiwafkhtm
    rnvadtglqilftllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasil
    aymfnlveegkistslnpgnpvnnqiflqeyvanllksafphlqdaqvklfvtglfslnq
    dipafkehlrdflvqikefag