PDB entry 1w9b

View 1w9b on RCSB PDB site
Description: s. alba myrosinase in complex with carba-glucotropaeolin
Class: hydrolase
Keywords: thioglucosidase, thioglycosidase, myrosinase, hydrolase, thio-glucoside, thiohydroximate, glusosinolate, glucotropaeolin
Deposited on 2004-10-08, released 2005-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: glycosidase
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9B (Start-500)
    Domains in SCOPe 2.07: d1w9bm_
  • Heterogens: NAG, CGT, GOL, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1w9bM (M:)
    deeitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypn
    ksgpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidy
    yhglisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvk
    ywltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdl
    yrknythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimi
    dtvgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyi
    nasghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenr
    nqsmldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidw
    nnvtdrdlkksgqwyqsfisp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9bM (M:)
    eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
    gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
    glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
    ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
    knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
    vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
    sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
    smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
    vtdrdlkksgqwyqsfisp