PDB entry 1w9a

View 1w9a on RCSB PDB site
Description: crystal structure of rv1155 from mycobacterium tuberculosis
Class: structural genomics, unknown function
Keywords: hypothetical protein, mycobacterium tuberculosis, structural genomics, related to fmn-binding proteins
Deposited on 2004-10-07, released 2005-01-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.14306
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv1155
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w9aa_
  • Chain 'B':
    Compound: hypothetical protein Rv1155
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w9ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9aA (A:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9aA (A:)
    fddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdp
    rasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamv
    tdrrvlltlpishvyglppgmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9aB (B:)
    marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrn
    lrrdprasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddy
    rqamvtdrrvlltlpishvyglppgmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9aB (B:)
    vfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrd
    prasilvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqam
    vtdrrvlltlpishvyglppgmr