PDB entry 1w98

View 1w98 on RCSB PDB site
Description: the structural basis of cdk2 activation by cyclin e
Class: transferase
Keywords: cell cycle, protein kinases, cyclin dependant kinases, cyclins, transferase
Deposited on 2004-10-07, released 2005-02-02
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.185
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w98a1
  • Chain 'B':
    Compound: g1/s-specific cyclin e1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w98b1, d1w98b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w98A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w98B (B:)
    iiapsrgsplpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmev
    cevyklhretfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfay
    vtdgacsgdeiltmelmimkalkwrlspltivswlnvymqvaylndlhevllpqypqqif
    iqiaelldlcvldvdclefpygilaasalyhfssselmqkvsgyqwcdiencvkwmvpfa
    mviretgssklkhfrgvadedahniqthrdsldlldkarakka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w98B (B:)
    splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
    retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
    gdeiltmelmimkalkwrlspltivswlnvymqvaylndlhevllpqypqqifiqiaell
    dlcvldvdclefpygilaasalyhfssselmqkvsgyqwcdiencvkwmvpfamviretg
    ssklkhfrgvadedahniqthrdsldlldk