PDB entry 1w97

View 1w97 on RCSB PDB site
Description: cyto-EpsL: the cytoplasmic domain of EpsL, an inner membrane component of the type II secretion system of Vibrio cholerae
Class: protein transport
Keywords: type II secretion, protein transport
Deposited on 2004-10-06, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: type II secretion system protein l
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w97l1, d1w97l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1w97L (L:)
    megsvsefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvl
    laasdliltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrl
    wlracldhlkacgfdvkrvlpdvlaiprpehglaalqlgdewlvrksttqgmavdaqwls
    llaasdwvqnegeylplqaltplpelslaetqewryepsglvmqlltqealtskfnlltg
    sfklks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w97L (L:)
    sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd
    liltsveqlenmlpylledaqdvedvhfcvlskgretadvvgvdrlwlracldhlkacgf
    dvkrvlpdvlaiprpehglaalqlgdewlvrksttqgmavdaqwlsllaasdwvqnegey
    lplqaltplpelslaetqewryepsglvmqlltqealtskfnlltgsfkl