PDB entry 1w96

View 1w96 on RCSB PDB site
Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae in complex with soraphen a
Deposited on 2004-10-06, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w96A (A:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96A (A:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgtveyliklletedfednti
    ttgwlddli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w96B (B:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96B (B:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritgtlhelnfrsssnvwgyfsvgnngnihsfsds
    qfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedfedntittgwldd
    li
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w96C (C:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96C (C:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveylikllete