PDB entry 1w96

View 1w96 on RCSB PDB site
Description: crystal structure of biotin carboxylase domain of acetyl-coenzyme a carboxylase from saccharomyces cerevisiae in complex with soraphen a
Class: ligase
Keywords: ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design, allosteric inhibition, polyketide
Deposited on 2004-10-06, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w96a1, d1w96a2, d1w96a3
  • Chain 'B':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w96b1, d1w96b2, d1w96b3
  • Chain 'C':
    Compound: acetyl-coenzyme a carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w96c1, d1w96c2, d1w96c3
  • Heterogens: S1A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w96A (A:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96A (A:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgtveyliklletedfednti
    ttgwlddli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w96B (B:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96B (B:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritgtlhelnfrsssnvwgyfsvgnngnihsfsds
    qfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedfedntittgwldd
    li
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w96C (C:)
    kmeyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaav
    keirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvd
    livdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiv
    aqsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmik
    aseggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtni
    slfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshdd
    gkfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsasei
    dfefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsv
    gnngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveyliklletedf
    edntittgwlddli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w96C (C:)
    meyeitnyserhtelpghfiglntvdkleesplrdfvkshgghtviskilianngiaavk
    eirsvrkwayetfgddrtvqfvamatpedleanaeyirmadqyievpggtnnnnyanvdl
    ivdiaeradvdavwagwghasenpllpeklsqskrkvifigppgnamrslgdkisstiva
    qsakvpcipwsgtgvdtvhvdektglvsvdddiyqkgcctspedglqkakrigfpvmika
    seggggkgirqvereedfialyhqaaneipgspifimklagrarhlevqlladqygtnis
    lfgrdcsvqrrhqkiieeapvtiakaetfhemekaavrlgklvgyvsagtveylyshddg
    kfyflelnprlqvehpttemvsgvnlpaaqlqiamgipmhrisdirtlygmnphsaseid
    fefktqdatkkqrrpipkghctacritsedpndgfkpsggtlhelnfrsssnvwgyfsvg
    nngnihsfsdsqfghifafgenrqasrkhmvvalkelsirgdfrttveylikllete