PDB entry 1w94

View 1w94 on RCSB PDB site
Description: crystal structure of mil (mth680), an archaeal imp4-like protein
Class: archaeal imp4-brix domain
Keywords: archaeal imp4-brix domain, imp4 domain, brix domain, RNA-binding protein
Deposited on 2004-10-06, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable brix-domain ribosomal biogenesis protein
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W94 (0-0)
    • Uniprot O26776 (1-End)
    Domains in SCOPe 2.07: d1w94a1
  • Chain 'B':
    Compound: Probable brix-domain ribosomal biogenesis protein
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W94
    • Uniprot O26776 (1-End)
    Domains in SCOPe 2.07: d1w94b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w94A (A:)
    hmllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpar
    itflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrda
    wsirtdeeyawvmelmdargtpagfkllirdfrvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w94A (A:)
    hmllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpar
    itflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrda
    wsirtdeeyawvmelmdargtpagfkllirdfrvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w94B (B:)
    hmllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpar
    itflderggergyilfnpsfemkkpeladkavrvsscppgseglcnlmglevdesssrda
    wsirtdeeyawvmelmdargtpagfkllirdfrvge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w94B (B:)
    mllttsrkpsqrtrsfsqrlsrimgwryinrgkmslrdvlieargpvavvserhgnpari
    tflderggergyilfnpsfemkkpekavrvsscppgseglcnlmglevdesrdawsirtd
    eeyawvmelmdargtpagfkllirdfrvg