PDB entry 1w92

View 1w92 on RCSB PDB site
Description: The structure of carbomonoxy murine neuroglobin reveals a heme- sliding mechanism for affinity regulation
Class: oxygen storage/transport
Keywords: CARBOMONOXY NEUROGLOBIN, GLOBIN, HEME-SLIDING, OXYGEN STORAGE/TRANSPORT, OXYGEN STORAGE-TRANSPORT complex
Deposited on 2004-10-05, released 2004-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.26
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered mutation (54)
      • engineered mutation (119)
    Domains in SCOPe 2.04: d1w92a_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w92A (A:)
    merpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspe
    fldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymleks
    lgpdftpatrtawsrlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w92A (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgw