PDB entry 1w91

View 1w91 on RCSB PDB site
Description: crystal structure of 1,4-beta-d-xylan xylohydrolase solve using anomalous signal from seleniomethionine
Class: hydrolase
Keywords: xylosidase, mad, semet, tetramer, hydrolase
Deposited on 2004-10-05, released 2006-02-01
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91a1, d1w91a2
  • Chain 'B':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91b1, d1w91b2
  • Chain 'C':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91c1, d1w91c2
  • Chain 'D':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91d1, d1w91d2
  • Chain 'E':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91e1, d1w91e2
  • Chain 'F':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91f1, d1w91f2
  • Chain 'G':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91g1, d1w91g2
  • Chain 'H':
    Compound: beta-xylosidase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZFM2 (447-End)
      • conflict (444-445)
    • PDB 1W91 (446-446)
    Domains in SCOP 1.75: d1w91h1, d1w91h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w91A (A:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91A (A:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w91B (B:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91B (B:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w91C (C:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91C (C:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w91D (D:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91D (D:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w91E (E:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91E (E:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w91F (F:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91F (F:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w91G (G:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91G (G:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w91H (H:)
    mktvnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsdd
    vgiyreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgn
    vtppkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklye
    vtaravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktf
    eyyyqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayia
    rilseggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
    ellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqy
    gnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtliei
    eqvrdetstyvglddgeitsyss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w91H (H:)
    vnvpsngrekfkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgi
    yreveidgemkpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtp
    pkdynkwrdlivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevta
    ravksvdphlqvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyy
    yqeleppedmleqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiaril
    seggdyvdsfsywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgdell
    yrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsavfikrqivneqygna
    wrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsivlsknevtlieieqv
    rdetstyvglddgeitsys