PDB entry 1w90

View 1w90 on RCSB PDB site
Description: cbm29-2 mutant d114a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Class: carbohydrate binding domain
Keywords: carbohydrate binding domain, carbohydrate binding module, glucomannan, cellohexaose, mannohexaose, cellulosome
Deposited on 2004-10-01, released 2005-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171 (Start-144)
      • engineered mutation (113)
    • PDB 1W90 (145-152)
    Domains in SCOPe 2.07: d1w90a1, d1w90a2
  • Chain 'B':
    Compound: non-catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171 (Start-144)
      • engineered mutation (113)
    • PDB 1W90
    Domains in SCOPe 2.07: d1w90b_
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w90A (A:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapg
    ngdriwiknlvhstgsaddfvdpinlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w90A (A:)
    vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
    lrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapgng
    driwiknlvhstgsaddfvdpinlehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w90B (B:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapg
    ngdriwiknlvhstgsaddfvdpinlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w90B (B:)
    ratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggsl
    rfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdriafqdapgngd
    riwiknlvhstgsaddfvdpin