PDB entry 1w8z

View 1w8z on RCSB PDB site
Description: cbm29-2 mutant k85a: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Class: carbohydrate binding domain
Keywords: carbohydrate binding domain, carbohydrate binding module, glucomannan, cellohexaose, mannohexaose, cellulosome
Deposited on 2004-10-01, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171 (Start-144)
      • engineered mutation (84)
    • PDB 1W8Z (145-End)
    Domains in SCOPe 2.07: d1w8za_
  • Chain 'B':
    Compound: non catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171
      • engineered mutation (84)
    • PDB 1W8Z
    Domains in SCOPe 2.07: d1w8zb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8zA (A:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadeafevetispsdeyvtyildvdfdlpfdridfqdapg
    ngdriwiknlvhstgsaddfvdpinlhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8zA (A:)
    vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
    lrfdmknegkvkilvenseadeafevetispsdeyvtyildvdfdlpfdridfqdapgng
    driwiknlvhstgsaddfvdpinlhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8zB (B:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseadeafevetispsdeyvtyildvdfdlpfdridfqdapg
    ngdriwiknlvhstgsaddfvdpinlhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8zB (B:)
    atytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggslr
    fdmknegkvkilvenseadeafevetispsdeyvtyildvdfdlpfdridfqdapgngdr
    iwiknlvhstgsaddfvdpi