PDB entry 1w8x

View 1w8x on RCSB PDB site
Description: Structural analysis of PRD1
Class: virus
Keywords: virus, p3 major capsid protein, p30 tape measure, p31 penton protein, p16 membrane protein, virus/viral protein, icosahedral virus
Deposited on 2004-10-01, released 2004-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xa_
  • Chain 'B':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xb_
  • Chain 'C':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xc_
  • Chain 'D':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xd_
  • Chain 'E':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xe_
  • Chain 'F':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xf_
  • Chain 'G':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xg_
  • Chain 'H':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xh_
  • Chain 'I':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xi_
  • Chain 'J':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xj_
  • Chain 'K':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xk_
  • Chain 'L':
    Compound: major capsid protein (protein p3)
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xl_
  • Chain 'M':
    Compound: protein p30
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xm_
  • Chain 'N':
    Compound: protein p31
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xn_
  • Chain 'P':
    Compound: protein p16
    Species: ENTEROBACTERIA PHAGE PRD1 [TaxId:10658]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8xp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8xA (A:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xA (A:)
    qqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflv
    kvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapfl
    ssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskq
    rlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilp
    lidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrt
    anfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqn
    arllmgyeyftsrtelvnag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8xB (B:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xB (B:)
    vqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvg
    ivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvnta
    kqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavla
    nvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvg
    qngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdi
    nylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvn
    pktvnqnarllmgyeyftsrtelvnagtistt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8xC (C:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xC (C:)
    qqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgi
    vkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntak
    qgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlan
    vpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq
    ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
    ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
    ktvnqnarllmgyeyftsrtelvna
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8xD (D:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xD (D:)
    vqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvg
    ivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvnta
    kqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavla
    nvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvg
    qngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdi
    nylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvn
    pktvnqnarllmgyeyftsrtelvnagtistt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w8xE (E:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xE (E:)
    ltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivk
    gflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqg
    apflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvp
    qskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqng
    yilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinyl
    sqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpkt
    vnqnarllmgyeyftsrt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w8xF (F:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xF (F:)
    ltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivk
    gflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqg
    apflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvp
    qskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqng
    yilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinyl
    sqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpkt
    vnqnarllmgyeyftsrtelvnagtist
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w8xG (G:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xG (G:)
    alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
    aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
    vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
    lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
    lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
    sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
    lmgyeyftsrtelvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w8xH (H:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xH (H:)
    vqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvg
    ivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvnta
    kqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavla
    nvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvg
    qngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdi
    nylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvn
    pktvnqnarllmgyeyftsrtelvnagtistt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w8xI (I:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xI (I:)
    vqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvg
    ivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvnta
    kqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavla
    nvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvg
    qngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdi
    nylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvn
    pktvnqnarllmgyeyftsrtelvnagtistt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w8xJ (J:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xJ (J:)
    vqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvg
    ivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvnta
    kqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavla
    nvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvg
    qngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdi
    nylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvn
    pktvnqnarllmgyeyftsrtelvnagtis
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1w8xK (K:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xK (K:)
    qqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgi
    vkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntak
    qgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlan
    vpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgq
    ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
    ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
    ktvnqnarllmgyeyftsrtelvn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1w8xL (L:)
    maqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpa
    nvgivkgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfv
    ntakqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltga
    vlanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldql
    pvgqngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnag
    tdinylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgf
    vvnpktvnqnarllmgyeyftsrtelvnagtistt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xL (L:)
    qltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgiv
    kgflvkvtaaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakq
    gapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanv
    pqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqn
    gyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdiny
    lsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpk
    tvnqnarllmgyeyftsrt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w8xM (M:)
    alinpqfpyagpvpipgpaptetmpllnyrvegriagiqqarqfmpflqgphravaeqty
    haigtgiqmgqtfnqplintqeg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1w8xN (N:)
    mnvnnpnqmtvtpvyngcdsgegpqsvrgyfdavagenvkydltyladtqgftgvqciyi
    dnaendgafeidveetgqrikcpagkqgyfpllvpgrakfvarhlgsgkksvplfflnft
    iaqgvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xN (N:)
    npnqmtvtpvyngcdsgegpqsvrgyfdavagenvkydltyladtqgftgvqciyidnae
    ndgafeidveetgqrikcpagkqgyfpllvpgrakfvarhlgsgkksvplffln
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1w8xP (P:)
    mdkkkllywvggglvliliwlwfrnrpaaqvasnwegppymtynqpqagsvtlpvagyts
    psptlpnrnrscgcnpavsaamaqgadlaskltdsitsqlndyasslndylasqagv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8xP (P:)
    mdkkkllywvggglvliliwlwfrnrpaaqvasnwegppymtynqpqagsvtlpvadsit
    sqlndyasslndylasqagv