PDB entry 1w8v

View 1w8v on RCSB PDB site
Description: enzymatic and structural characterization of non peptide ligand cyclophilin complexes
Class: isomerase
Keywords: 3d-structure, complex (isomerase/immunosuppressant), native high resolution, isomerase, multigene family, rotamase
Deposited on 2004-09-28, released 2004-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W8V (0-0)
    • Uniprot P62937 (1-164)
    Domains in SCOPe 2.05: d1w8va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w8vA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle