PDB entry 1w8v

View 1w8v on RCSB PDB site
Description: enzymatic and structural characterization of non peptide ligand cyclophilin complexes
Class: isomerase
Keywords: 3d-structure, complex (isomerase/immunosuppressant), native high resolution, isomerase, multigene family, rotamase
Deposited on 2004-09-28, released 2004-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w8va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w8vA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle