PDB entry 1w8u

View 1w8u on RCSB PDB site
Description: cbm29-2 mutant d83a complexed with mannohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Class: carbohydrate-binding domain
Keywords: carbohydrate-binding domain, carbohydrate binding module, glucomannan, cellohexaose, mannohexaose, cellulosome
Deposited on 2004-09-28, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.162
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non catalytic protein 1
    Species: PIROMYCES EQUI [TaxId:99929]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9C171
      • engineered mutation (82)
    • PDB 1W8U
    Domains in SCOPe 2.07: d1w8ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8uA (A:)
    snvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
    gslrfdmknegkvkilvenseaaekfevetispsdeyvtyildvdfdlpfdridfqdapg
    ngdriwiknlvhstgsaddfvdpinlehh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8uA (A:)
    vratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggs
    lrfdmknegkvkilvenseaaekfevetispsdeyvtyildvdfdlpfdridfqdapgng
    driwiknlvhstgsaddfvdp