PDB entry 1w8q

View 1w8q on RCSB PDB site
Description: crystal structure of the dd-transpeptidase-carboxypeptidase from actinomadura r39
Class: hydrolase
Keywords: penicillin-binding, peptidoglycan, actinomadura, transpeptidase, antibiotic resistance, hydrolase
Deposited on 2004-09-24, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. [TaxId:72570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8qa_
  • Chain 'B':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. [TaxId:72570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8qb_
  • Chain 'C':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. [TaxId:72570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8qc_
  • Chain 'D':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. [TaxId:72570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8qd_
  • Heterogens: SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8qA (A:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8qA (A:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8qB (B:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8qB (B:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8qC (C:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8qC (C:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8qD (D:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8qD (D:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg