PDB entry 1w8p

View 1w8p on RCSB PDB site
Description: structural properties of the b25tyr-nme-b26phe insulin mutant.
Deposited on 2004-09-24, released 2005-02-03
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Chain 'C':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Chain 'E':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Chain 'G':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Chain 'I':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Chain 'K':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-End)
      • engineered mutation (24-25)
  • Heterogens: IPH, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1w8pB (B:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pB (B:)
    fvnqhlcgshlvealylvcgergfyftpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1w8pD (D:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pD (D:)
    fvnqhlcgshlvealylvcgergfyftp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pE (E:)
    giveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1w8pF (F:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pF (F:)
    fvnqhlcgshlvealylvcgergfyftpk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pG (G:)
    giveqcctsicslyqlenycn
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1w8pH (H:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pH (H:)
    fvnqhlcgshlvealylvcgergfyftp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pI (I:)
    giveqcctsicslyqlenycn
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >1w8pJ (J:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pJ (J:)
    fvnqhlcgshlvealylvcgergfyftpk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1w8pK (K:)
    giveqcctsicslyqlenycn
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >1w8pL (L:)
    fvnqhlcgshlvealylvcgergfyftpkt
    

    Sequence, based on observed residues (ATOM records):
    >1w8pL (L:)
    fvnqhlcgshlvealylvcgergfyftp