PDB entry 1w8o

View 1w8o on RCSB PDB site
Description: contribution of the active site aspartic acid to catalysis in the bacterial neuraminidase from micromonospora viridifaciens
Class: hydrolase
Keywords: 3d-structure, glycosidase, hydrolase, sialidase, beta-propeller
Deposited on 2004-09-24, released 2004-09-29
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial sialidase
    Species: Micromonospora viridifaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (45)
    Domains in SCOP 1.75: d1w8oa1, d1w8oa2, d1w8oa3
  • Heterogens: LBT, NA, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w8oA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgigapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r