PDB entry 1w8l

View 1w8l on RCSB PDB site
Description: enzymatic and structural characterization of non peptide ligand cyclophilin complexes
Deposited on 2004-09-23, released 2004-09-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-30, with a file datestamp of 2004-09-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w8la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w8lA (A:)
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle