PDB entry 1w8j

View 1w8j on RCSB PDB site
Description: crystal structure of myosin v motor domain -nucleotide-free
Class: motor protein
Keywords: motor protein, unconventional myosin, myosin v, chicken, molecular motor, ATPase, elc, iq motif, muscle protein, ATP-binding motor protein
Deposited on 2004-09-22, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2574
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin va
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8ja1, d1w8ja2
  • Chain 'B':
    Compound: myosin va
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8jb1, d1w8jb2
  • Chain 'C':
    Compound: myosin va
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8jc1, d1w8jc2
  • Chain 'D':
    Compound: myosin va
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8jd1, d1w8jd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8jA (A:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8jA (A:)
    aaselytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelpplrnp
    dilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygediin
    aysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvsn
    veekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksrvvf
    qaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvntrqa
    ctllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdyeem
    ahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqhs
    figvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwtlidfyd
    nqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafiik
    hfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqtskehkktvghqfrnsl
    hllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwty
    qeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekira
    dk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8jB (B:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8jB (B:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelpplrn
    pdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygedii
    naysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvs
    nveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksrvv
    fqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvntrq
    actllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdyee
    mahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqh
    sfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwtlidfy
    dnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafii
    khfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqtskehkktvghqfrns
    lhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwt
    yqeffsryrvlmkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekira
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8jC (C:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8jC (C:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelpplrn
    pdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygedii
    naysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvs
    nveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksrvv
    fqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvntrq
    actllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdyee
    mahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqh
    sfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwtlidfy
    dnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafii
    khfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqtskehkktvghqfrns
    lhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwt
    yqeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekir
    adk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8jD (D:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8jD (D:)
    elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelpplrnpdil
    vgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygediinays
    gqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvsgsan
    veekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksrvvf
    qaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakemvntrqa
    ctllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmgvdyeem
    ahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnkalhstvkqhs
    figvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipdfydnqpc
    inlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafiikhfad
    kveyqcegfleknkdtvyeeqikvlksskkfkllpelftskehkktvghqfrnslhllme
    tlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffs
    ryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradk