PDB entry 1w8i

View 1w8i on RCSB PDB site
Description: The Structure of gene product af1683 from Archaeoglobus fulgidus.
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, archaeoglobus fulgidus, hypothetical protein, psi, protein structure initiative, mcsg, midwest center for structural genomics
Deposited on 2004-09-22, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative vapc ribonuclease af_1683
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w8ia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8iA (A:)
    maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa
    dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy
    dsrfslptigrdywksldeserkrisailrekgidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8iA (A:)
    maalidtgiffgfyslkdvhhmdsvaivvhavegkwgrlfvtnhildetltllkykklpa
    dkflegfvesgvlniiytddeverkalevfkarvyekgfsytdaisevvaeelklklisy
    dsrfslptigrdywksldeserkrisailrekgid