PDB entry 1w8h

View 1w8h on RCSB PDB site
Description: structure of pseudomonas aeruginosa lectin II (PA-IIL)complexed with lewisA trisaccharide
Class: sugar binding protein
Keywords: sugar binding protein, lectin, sugar, lewis a, cystic fibrosis
Deposited on 2004-09-21, released 2005-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w8ha_
  • Chain 'B':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w8hb_
  • Chain 'C':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w8hc_
  • Chain 'D':
    Compound: pseudomonas aeruginosa lectin II
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w8hd_
  • Heterogens: CA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8hA (A:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8hA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8hB (B:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8hB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8hC (C:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8hC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8hD (D:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8hD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg