PDB entry 1w8g

View 1w8g on RCSB PDB site
Description: crystal structure of e. coli k-12 yggs
Deposited on 2004-09-21, released 2006-07-05
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical upf0001 protein yggs
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PLP, ICT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w8gA (A:)
    mndiahnlaqvrdkisaaatrcgrspeeitllavsktkpasaiaeaidagqrqfgenyvq
    egvdkirhfqelgvtglewhfigplqsnksrlvaehfdwchtidrlriatrlndqrpael
    pplnvliqinisdensksgiqlaeldelaaavaelprlrlrglmaipapeseyvrqfeva
    rqmavafaglktryphidtlslgmsddmeaaiaagstmvrigtaifgardyskk
    

    Sequence, based on observed residues (ATOM records):
    >1w8gA (A:)
    diahnlaqvrdkisaaatrcgrspeeitllavsktkpasaiaeaidagqrqfgenyvqeg
    vdkirhfqelgvtglewhfigplqsnksrlvaehfdwchtidrlriatrlndqrpaelpp
    lnvliqinisdensksgiqlaeldelaaavaelprlrlrglmaipapeseyvrqfevarq
    mavafaglktryphidtlslgmsddmeaaiaagstmvrigtaifga