PDB entry 1w8f

View 1w8f on RCSB PDB site
Description: pseudomonas aeruginosa lectin II (pa-iil) complexed with lacto-n-neo-fucopentaose v(lnpfv)
Class: lectin
Keywords: lectin,pentassacharide,cystic firosis,pseudomonas aeruginosa,infection of lungs
Deposited on 2004-09-21, released 2005-03-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.10613
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudomonas aeruginosa lectin II
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w8fa1
  • Chain 'B':
    Compound: pseudomonas aeruginosa lectin II
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w8fb1
  • Chain 'C':
    Compound: pseudomonas aeruginosa lectin II
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w8fc1
  • Chain 'D':
    Compound: pseudomonas aeruginosa lectin II
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w8fd1
  • Heterogens: SO4, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8fA (A:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8fA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8fB (B:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8fB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8fC (C:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8fC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8fD (D:)
    matqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgs
    sgkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8fD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg