PDB entry 1w8d

View 1w8d on RCSB PDB site
Description: binary structure of human decr.
Class: oxidoreductase
Keywords: short chain dehydrogenase, reductase, selenomethionine, sad, dienoyl-coa, oxidoreductase
Deposited on 2004-09-20, released 2004-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W8D
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w8da_
  • Chain 'B':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W8D (0-0)
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w8db_
  • Chain 'C':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w8dc_
  • Chain 'D':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W8D (0-0)
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w8dd_
  • Heterogens: GOL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w8dA (A:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8dA (A:)
    ntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmd
    vlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispte
    rlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasak
    agveamskslaaewgkygmrfnviqpgpiktldptgtfekemigripcgrlgtveelanl
    aaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w8dB (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8dB (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpikekemigripcgrlgtveelanlaaflcsd
    yaswingavikfdggeevlisgefndlrkvtkeqwdtieeli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w8dC (C:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8dC (C:)
    tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
    lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
    lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
    gveamskslaaewgkygmrfnviqpgpikttgtfekemigripcgrlgtveelanlaafl
    csdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w8dD (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w8dD (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkemigripcgrlgtveelanlaaflcsd
    yaswingavikfdggeevlisgefndlrkvtkeqwdtiee