PDB entry 1w88

View 1w88 on RCSB PDB site
Description: the crystal structure of pyruvate dehydrogenase e1(d180n, e183q) bound to the peripheral subunit binding domain of e2
Class: oxidoreductase
Keywords: pyruvate dehydrogenase, dihydrolipoyl, acetyl transferase, multienzyme complex, oxidoreductase, transferase, catalysis, slinky
Deposited on 2004-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21873 (Start-367)
      • engineered mutation (179)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d1w88a_
  • Chain 'B':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88b1, d1w88b2
  • Chain 'C':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21873 (Start-367)
      • engineered mutation (179)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d1w88c_
  • Chain 'D':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88d1, d1w88d2
  • Chain 'E':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21873 (Start-367)
      • engineered mutation (179)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d1w88e_
  • Chain 'F':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88f1, d1w88f2
  • Chain 'G':
    Compound: pyruvate dehydrogenase e1 component, alpha subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21873 (Start-367)
      • engineered mutation (179)
      • engineered mutation (182)
    Domains in SCOPe 2.06: d1w88g_
  • Chain 'H':
    Compound: pyruvate dehydrogenase e1 component, beta subunit
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88h1, d1w88h2
  • Chain 'I':
    Compound: dihydrolipoyllysine-residue acetyltransferase component of pyruvate
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88i_
  • Chain 'J':
    Compound: dihydrolipoyllysine-residue acetyltransferase component of pyruvate
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1w88j_
  • Heterogens: MG, TDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w88A (A:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgn
    fyqginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88A (A:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
    infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa
    vkaareraingegptlietlcfrykkdplvrfrkfleakglwseeeennvieqakeeike
    aikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w88B (B:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w88C (C:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgn
    fyqginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88C (C:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
    infagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavyaa
    vkaareraingegptlietlcfrywakkdplvrfrkfleakglwseeeennvieqakeei
    keaikkadetpkqkvtdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w88D (D:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w88E (E:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgn
    fyqginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88E (E:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
    infagafkapaifvvqnnrfaaktlaqkavaagipgiqvdgmdplavyaavkaarerain
    gegptlietlckkdplvrfrkfleakglwseeeennvieqakeeikeaikkadetpkqkv
    tdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w88F (F:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88F (F:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiyevmdsicgqmariryrtggryhmpitirspfghsdsleg
    lvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfrqevpegeytipigk
    adikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldietiigsvektg
    raivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesvwlpnfkdv
    ietakkvmnf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w88G (G:)
    gvktfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrild
    qrsislnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqafl
    fsrghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgn
    fyqginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdpla
    vyaavkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfr
    kfleakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqye
    iykekesk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88G (G:)
    fqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrsi
    slnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsrg
    hfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgnfyqg
    infagafkapaifvvqnnrfaqtvaktlaqkavaagipgiqvdgmdplavyaavkaarer
    aingegptlietlckkdplvrfrkfleakglwseeeennvieqakeeikeaikkadetpk
    qkvtdlisimfeelpfnlkeqyeiykekesk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w88H (H:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
    qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
    ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
    aqaesvwlpnfkdvietakkvmnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88H (H:)
    aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
    gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
    gsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfrqevpege
    ytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqpldietii
    gsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypfaqaesvw
    lpnfkdvietakkvmnf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w88I (I:)
    agpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88I (I:)
    rviampsvrkyarekgvdirlvqgtgkngrvlkedidafl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w88J (J:)
    agpnrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w88J (J:)
    rviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg