PDB entry 1w87

View 1w87 on RCSB PDB site
Description: ferredoxin-nadp reductase (mutation: y 303 w) complexed with nadp by cocrystallization
Class: oxidoreductase
Keywords: oxidoreductase, 3d-structure, fad, flavoprotein, fnr, nadp, nadp reductase, phycobilisome, thylakoid
Deposited on 2004-09-16, released 2005-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: ANABAENA SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • conflict (246)
      • engineered mutation (303)
    Domains in SCOPe 2.07: d1w87a1, d1w87a2
  • Chain 'B':
    Compound: ferredoxin-nadp reductase
    Species: ANABAENA SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • conflict (246)
      • engineered mutation (303)
    Domains in SCOPe 2.07: d1w87b1, d1w87b2
  • Heterogens: FAD, NAP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w87A (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vetw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w87A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w87B (B:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vetw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w87B (B:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw