PDB entry 1w81

View 1w81 on RCSB PDB site
Description: crystal structure of apical membrane antigen 1 from plasmodium vivax
Deposited on 2004-09-15, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1
    Species: PLASMODIUM VIVAX [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W81 (0-1)
      • conflict (11)
      • engineered mutation (137)
      • engineered mutation (185)
      • engineered mutation (400)
      • conflict (431)
    • Uniprot Q9TY14 (2-End)
  • Heterogens: IMD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w81A (A:)
    siptverstrmsnpwkafmekydierthssgvrvdlgedaevenakyripagrcpvfgkg
    iviensdvsflrpvatgdqklkdggfafpnandhispmtlanlkerykdnvemmklndia
    lcrthaasfvmagdqnsnyrhpavydekektchmlylsaqenmgprycspdaqnrdavfc
    fkpdkdesfenlvylsknvrndwdkkcprknlgnakfglwvdgnceeipyvkeveaedlr
    ecnrivfgasasdqptqyeeemtdyqkiqqgfrqnnremiksaflpvgafnsdnfkskgr
    gfnwanfdsvkkkcyifntkptclindknfiattalshpqevdlefpcsiykdeiereik
    kqsrnmnlysvdgerivlprifisndkesikcpceperisqstcnfyvcncvekraeike
    nnqvvikeefrdyyengeeksnkqmll
    

    Sequence, based on observed residues (ATOM records):
    >1w81A (A:)
    siptverstrmsnpwkafmekydierthssgvrvdlgedaevenakyripagrcpvfgkg
    iviensdvsflrpvatgdqklkdggfafpnandhispmtlanlkerykdnvemmklndia
    lcrthaasfvqnsnyrhpavydekektchmlylsaqenmgfcfkpdkdesfenlvylskn
    vrndwdkkcprknlgnakfglwvdgnceeipyvkeveaedlrecnrivfgasasdqfksk
    grgfnwanfdsvkkkcyifntkptclindknfiattalshpqevdlefpcsiykdeiere
    ikgerivlprifisndkesikcpceperisqstcnfyvcncvekraeikennqvvikeef
    rdyy