PDB entry 1w80

View 1w80 on RCSB PDB site
Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, bound to 2 peptides from synaptojanin170
Class: endocytosis/exocytosis
Keywords: endocytosis/exocytosis, endocytosis, alpha-adaptin appendage, adaptor complex, ap2, synaptojanin, exocytosis, lipid-binding
Deposited on 2004-09-14, released 2004-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adapter-related protein complex 2 alpha 2 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W80 (Start-5)
      • conflict see remark 9 (200-201)
    • Uniprot P17427 (6-249)
    Domains in SCOPe 2.07: d1w80a1, d1w80a2, d1w80a3
  • Chain 'P':
    Compound: synaptojanin 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: synaptojanin 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: BEN, CO3, DTD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w80A (A:)
    gspgilaplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstq
    flnftptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryg
    gtfqnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkak
    iigfgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsq
    rlcellseqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w80A (A:)
    pgilaplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfl
    nftptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggt
    fqnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakii
    gfgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrl
    cellseqf
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.