PDB entry 1w7z

View 1w7z on RCSB PDB site
Description: crystal structure of the free (uncomplexed) ecballium elaterium trypsin inhibitor (eeti-II)
Class: protease inhibitor
Keywords: squash seed inhibitor, cystein knot, ecballium elaterium, trypsin, protease inhibitor
Deposited on 2004-09-14, released 2005-11-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.197
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7za_
  • Chain 'B':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zb_
  • Chain 'C':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zc_
  • Chain 'D':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zd_
  • Chain 'E':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7ze_
  • Chain 'F':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zf_
  • Chain 'G':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zg_
  • Chain 'H':
    Compound: trypsin inhibitor II
    Species: ECBALLIUM ELATERIUM [TaxId:3679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1w7zh_
  • Heterogens: NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7zA (A:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7zB (B:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7zC (C:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7zD (D:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w7zE (E:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7zE (E:)
    gcprilirckqdsdclagcvcgpngfcgsp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w7zF (F:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w7zG (G:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7zG (G:)
    gcprilirckqdsdclagcvcgpngfcgsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w7zH (H:)
    gcprilirckqdsdclagcvcgpngfcgspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7zH (H:)
    gcprilirckqdsdclagcvcgpngfcgsp