PDB entry 1w7w

View 1w7w on RCSB PDB site
Description: Structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization.
Class: transferase
Keywords: mitochondrial nucleoside diphosphate kinase, ndpk3, pisum sativum, transferase, kinase
Deposited on 2004-09-13, released 2004-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7wa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7wb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7wc_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7wd_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7we_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7W
    • Uniprot Q9SP13 (29-End)
    Domains in SCOPe 2.07: d1w7wf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7wA (A:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wA (A:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7wB (B:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wB (B:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w7wC (C:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wC (C:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w7wD (D:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wD (D:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w7wE (E:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wE (E:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiyg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w7wF (F:)
    msyyhhhhhhdydypttenlyfqgamdpeaelertfiaikpdgvqrgliseiisrferkg
    fklvgikvliptkqfaqqhyhdlkerpffnglcdflssgpviamvwegegvitygrklig
    atdpqksapgtirgdlavvvgrniihgsdgpetakdeiklwfkpeelvsftsnsekwiyg
    dn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7wF (F:)
    aelertfiaikpdgvqrgliseiisrferkgfklvgikvliptkqfaqqhyhdlkerpff
    nglcdflssgpviamvwegegvitygrkligatdpqksapgtirgdlavvvgrniihgsd
    gpetakdeiklwfkpeelvsftsnsekwiy