PDB entry 1w7t

View 1w7t on RCSB PDB site
Description: Photoproduct of the Wild-Type Aequorea victoria Green Fluorescent Protein at 100 K
Class: luminescent protein
Keywords: luminescent protein, beta-barrel, bioluminescence, photoproduct
Deposited on 2004-09-09, released 2005-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1w7ta_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1w7tb_
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1w7tc_
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d1w7td_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7tA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7tA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7tB (B:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7tB (B:)
    kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
    tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
    ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
    qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w7tC (C:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7tC (C:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w7tD (D:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7tD (D:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith