PDB entry 1w7p

View 1w7p on RCSB PDB site
Description: The crystal structure of endosomal complex ESCRT-II (VPS22/VPS25/VPS36)
Class: protein transport
Keywords: escrt-II complex, endosomal protein sorting, protein transport
Deposited on 2004-09-07, released 2004-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vps22, ypl002c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7pa1, d1w7pa2
  • Chain 'B':
    Compound: vps25, yjr102c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7pb1, d1w7pb2
  • Chain 'C':
    Compound: vps25, yjr102c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7pc1, d1w7pc2
  • Chain 'D':
    Compound: vps36p, ylr417w
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w7pd1, d1w7pd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7pA (A:)
    mkqfglaafdelkdgkyndvnktilekqsvelrdqlmvfqerlvefakkhnselqaspef
    rskfmhmcssigidplslfdrdkhlftvndfyyevclkvieicrqtkdmnggvisfqele
    kvhfrklnvglddleksidmlkslecfeifqirgkkflrsvpneltsdqtkileicsilg
    yssisllkanlgweavrsksaldemvangllwidyqggaealywdpswitrql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7pA (A:)
    vnktilekqsvelrdqlmvfqerlvefakkhnselqaspefrskfmhmcssigidplslf
    drdkhlftvndfyyevclkvieicrqtkdmnggvisfqelekvhfrklnvglddleksid
    mlkslecfeifqirgkkflrsvpneltsdqtkileicsilgyssisllkanlgweavrsk
    saldemvangllwidyqggaealywdpswitrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7pB (B:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7pB (B:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvinsknlfn
    nediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilq
    wfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnratmlkdendkvi
    ai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w7pC (C:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7pC (C:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvinsknlfn
    nediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilq
    wfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnratmlkdendkvi
    ai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w7pD (D:)
    meywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyidda
    kptqnslglelddlayvnyssgfltrsprlilffkdpsskdelgksaetasadvvstwvc
    picmvsnetqgeftkdtlptpicincgvpadyeltkssincsnaidpnanpqnqfgvnse
    nicpactfanhpqignceicghrlpnaskvrsklnrlnfhdsrvhieleknslarnkssh
    salssssstgsstefvqlsfrksdgvlfsqateralenilteknkhifnqnvvsvngvdm
    rkgassheynnevpfietklsrigissleksrenqllnndilfnnaltdlnklmslatsi
    erlyknsnitmktktlnlqdestvnepktrrpllildrekflnkelfldeiareiyeftl
    sefkdlnsdtnymiitlvdlyamynksmrigtglispmemreacerfehlglnelklvkv
    nkrilcvtsekfdvvkeklvdligdnpgsdllrltqilssnnsksnwtlgilmevlqncv
    degdllidkqlsgiyyyknsywpshi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7pD (D:)
    ldrekflnkelfldeiareiyeftlsefkdlnsdtnymiitlvdlyamynksmrigtgli
    spmemreacerfehlglnelklvkvnkrilcvtsekfdvvkeklvdligdnpgsdllrlt
    qilssnnsksnwtlgilmevlqncvdegdllidkqlsgiyyyknsywpshi