PDB entry 1w7l

View 1w7l on RCSB PDB site
Description: crystal structure of human kynurenine aminotransferase i
Deposited on 2004-09-06, released 2004-09-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-08, with a file datestamp of 2004-09-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19288
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w7la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7lA (A:)
    makqlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfml
    nqytktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdevii
    iepffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvl
    ntpnnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertl
    tigsagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfr
    qpssyfvqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavde
    pydrrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkv
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7lA (A:)
    qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
    tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
    ffdcyepmtmmaggrpvfvslkpgpgelgsssnwqldpmelagkftsrtkalvlntpnnp
    lgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltigsag
    ktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqpssyf
    vqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavdepydrrf
    vkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkve