PDB entry 1w7l

View 1w7l on RCSB PDB site
Description: Crystal structure of human kynurenine aminotransferase I
Class: transferase
Keywords: transferase, kynurenine pathway, kynurenic acid, plp-enzyme, aminotransferase, lyase, multifunctional enzyme, pyridoxal phosphate, transferase.
Deposited on 2004-09-06, released 2004-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine--oxoglutarate transaminase I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16773
      • conflict (331)
    Domains in SCOPe 2.07: d1w7la_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7lA (A:)
    makqlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfml
    nqytktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdevii
    iepffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvl
    ntpnnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertl
    tigsagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfr
    qpssyfvqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavde
    pydrrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkv
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7lA (A:)
    qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
    tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
    ffdcyepmtmmaggrpvfvslkpgpgelgsssnwqldpmelagkftsrtkalvlntpnnp
    lgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltigsag
    ktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqpssyf
    vqfpqamqrcrdhmirslqsvglkplipqgsyflitdisdfkrkmpdlpgavdepydrrf
    vkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkve