PDB entry 1w7k

View 1w7k on RCSB PDB site
Description: e.coli folc in complex with adp, without folate substrate
Deposited on 2004-09-06, released 2005-02-09
The last revision was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: folc bifunctional protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, SO4, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w7kA (A:)
    miikrtpqaasplaswlsylenlhsktidlglervslvaarlgvlkpapfvftvagtngk
    gttcrtlesilmaagykvgvyssphlvrytervrvqgqelpesahtasfaeiesargdis
    ltyfeygtlsalwlfkqaqldvvilevglggrldatnivdadvavvtsialdhtdwlgpd
    resigrekagifrsekpaivgepempstiadvaqekgallqrrgvewnysvtdhdwafsd
    ahgtlenlplplvpqpnaatalaalrasglevsenairdgiasailpgrfqivsesprvi
    fdvahnphaaeyltgrmkalpkngrvlavigmlhdkdiagtlawlksvvddwycaplegp
    rgataeqllehlgngksfdsvaqawdaamadakaedtvlvcgsfhtvahvmevidarrsg
    gk
    

    Sequence, based on observed residues (ATOM records):
    >1w7kA (A:)
    tpqaasplaswlsylenlidlglervslvaarlgvlkpapfvftvagtngkgttcrtles
    ilmaagykvgvyssphlvrytervrvqgqelpesahtasfaeiesargdisltyfeygtl
    salwlfkqaqldvvilevglggrldatnivdadvavvtsialdhtdwlgpdresigreka
    gifrsekpaivgepempstiadvaqekgallqrrgvewnysvtdhdwafsdahgtlenlp
    lplvpqpnaatalaalrasglevsenairdgiasailpgrfqivsesprvifdvahnpha
    aeyltgrmkalpkngrvlavigmlhdkdiagtlawlksvvddwycaplegprgataeqll
    ehlgngksfdsvaqawdaamadakaedtvlvcgsfhtvahvmevidarrsg