PDB entry 1w7i

View 1w7i on RCSB PDB site
Description: crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp
Class: motor protein
Keywords: unconventional myosin, myosin v, chicken, molecular motor, ATPase, elc, iq motif, muscle protein, mgadp, motor protein
Deposited on 2004-09-03, released 2005-02-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.252
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin va
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02440 (Start-791)
    • PDB 1W7I
    Domains in SCOP 1.75: d1w7ia1, d1w7ia2
  • Chain 'B':
    Compound: myosin light chain 1, slow-twitch muscle a isoform
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w7ib1
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7iA (A:)
    maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
    plrnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyg
    ediinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryf
    atvsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmr
    tylleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgid
    dakemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltif
    cdlmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvn
    kalhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymke
    qipwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfek
    prlsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekai
    sptsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvr
    cikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdv
    lsdrkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirg
    wlmrkkymrmrrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7iA (A:)
    elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelpplrn
    pdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiygedii
    naysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfatvs
    gsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtyll
    eksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddake
    mvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlm
    gvdyeemahwlchrklatyikpisklhainardalakhiyanlfnwivdhvnkalhstvk
    qhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwtlid
    fydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkaf
    iikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqhkktvghqfrnslh
    llmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyq
    effsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekirad
    klraaciriqktirgwlmrkkymrmrrgda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7iB (B:)
    miefnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdel
    ksrrvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekm
    teeevetvlaghedsngcinyeaflkhilsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7iB (B:)
    efnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelks
    rrvdfetflpmlqavaknrtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeev
    etvlaghedsngcinyeaflkhils