PDB entry 1w7f

View 1w7f on RCSB PDB site
Description: crystal structure of the class a beta-lactamase bs3 inhibited with isocitrate
Class: hydrolase
Keywords: hydrolase, beta-lactamase, isocitrate, bacillus licheniformis hydrolase
Deposited on 2004-09-01, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7F
    • Uniprot P94458 (265-End)
    Domains in SCOPe 2.07: d1w7fa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W7F
    • Uniprot P94458 (265-End)
    Domains in SCOPe 2.07: d1w7fb_
  • Heterogens: ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7fA (A:)
    mklwfstlklkkaaavllfscvalagcannqtnasqpaeknektemkddfakleeqfdak
    lgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnqritytrddlvnyn
    pitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelrkigdevtnperfe
    pelnevnpgetqdtstaralatslqafaledklpsekrellidwmkrnttgdaliragvp
    egwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyddkliaeatkvvvk
    alnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7fA (A:)
    ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
    kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
    nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvvkaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7fB (B:)
    mklwfstlklkkaaavllfscvalagcannqtnasqpaeknektemkddfakleeqfdak
    lgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnqritytrddlvnyn
    pitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelrkigdevtnperfe
    pelnevnpgetqdtstaralatslqafaledklpsekrellidwmkrnttgdaliragvp
    egwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyddkliaeatkvvvk
    alnmngk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7fB (B:)
    ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
    ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
    kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
    nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
    dkliaeatkvvvkaln