PDB entry 1w7e

View 1w7e on RCSB PDB site
Description: NMR Ensemble OF Fasciclin-Like Protein From Rhodobacter sphaeroides
Deposited on 2004-09-01, released 2006-03-08
The last revision was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ig-h3/fasciclin
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w7eA (A:)
    etgdivetatgagsfttlltaaeaaglvdtlkgdgpftvfaptdaafaalpegtvedllk
    penkeklteiltyhvvpgevmssdltegmtaetveggaltvtleggpkvngvsisqpdvd
    asngvihvidgvlmpga
    

    Sequence, based on observed residues (ATOM records):
    >1w7eA (A:)
    divetatgagsfttlltaaeaaglvdtlkgdgpftvfaptdaafaalpegtvedllkpen
    keklteiltyhvvpgevmssdltegmtaetveggaltvtleggpkvngvsisqpdvdasn
    gvihvidgvlmpg