PDB entry 1w7d

View 1w7d on RCSB PDB site
Description: nmr structure of fasciclin-like protein from rhodobacter sphaeroides
Deposited on 2004-09-01, released 2006-03-08
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ig-h3/fasciclin
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w7dA (A:)
    etgdivetatgagsfttlltaaeaaglvdtlkgdgpftvfaptdaafaalpegtvedllk
    penkeklteiltyhvvpgevmssdltegmtaetveggaltvtleggpkvngvsisqpdvd
    asngvihvidgvlmpga