PDB entry 1w7c

View 1w7c on RCSB PDB site
Description: PPLO at 1.23 Angstroms
Class: oxidoreductase
Keywords: amine oxidase, oxidoreductase, quinoprotein, topaquinone enzyme
Deposited on 2004-09-01, released 2006-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.113
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl oxidase
    Species: Pichia pastoris [TaxId:4922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96X16
      • conflict (273)
      • conflict (297)
      • conflict (376)
      • conflict (508)
      • conflict (536)
      • conflict (538)
      • conflict (609)
      • conflict (717)
      • conflict (720)
    Domains in SCOPe 2.07: d1w7ca1, d1w7ca2, d1w7ca3
  • Heterogens: CU, CA, MG, CL, IMD, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7cA (A:)
    asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
    lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
    tngksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlh
    dpatgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaee
    lyeamqkddfvtlpkidvdnldwtviqrndsapvrhlddrksprlvepegrrwaydgdee
    yfswmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdis
    ygvgnrfslvpgydcpstagyfttdtfeydefynrtlsycvfenqedysllrhtgasysa
    itqnptlnvrfistignydynflykffldgtlevsvraagyiqagywnpetsapyglkih
    dvlsgsfhdhvlnykvdldvggtknrasqyvmkdvdveypwapgtvyntkqiarevfene
    dfnginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwars
    nlfltkhkdtelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsnd
    lpntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscgvev
    aepnfedytygrgtrinkkmtnsdevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7cA (A:)
    aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk
    pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn
    gksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdp
    atgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeely
    eamqkddfvtlpkidvdnldwtviqrndsapvrhlddrksprlvepegrrwaydgdeeyf
    swmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdisyg
    vgnrfslvpgydcpstagyfttdtfeydefynrtlsycvfenqedysllrhtgasysait
    qnptlnvrfistignydynflykffldgtlevsvraagyiqagywnpetsapyglkihdv
    lsgsfhdhvlnykvdldvggtknrasqyvmkdvdveypwapgtvyntkqiarevfenedf
    nginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwarsnl
    fltkhkdtelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsndlp
    ntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscgvevae
    pnfedytygrgtrinkk